PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG646700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 426aa    MW: 45366.9 Da    PI: 4.9771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG646700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12.1e-18115161148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          +g+WT+eEd +l+  v+qlG + W+ Ia+ ++ gR +kqc++rw ++l
  Pavir.5KG646700.1.p 115 KGSWTEEEDSILKAMVTQLGERKWSVIAQSLP-GRIGKQCRERWINHL 161
                          799*****************************.************996 PP

2Myb_DNA-binding47.93.1e-15171210445
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          WT+e+d+ll+ a+k +G++ W++Iar ++ gR+++ +k++w+
  Pavir.5KG646700.1.p 171 WTEEDDKLLIGAHKYFGNR-WSSIARFLP-GRSENAIKNHWN 210
                          *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.747110165IPR017930Myb domain
SuperFamilySSF466892.41E-29114209IPR009057Homeodomain-like
SMARTSM007175.2E-16114163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-23115163IPR009057Homeodomain-like
PfamPF002491.1E-15115161IPR001005SANT/Myb domain
CDDcd001678.88E-15117161No hitNo description
Gene3DG3DSA:1.10.10.605.4E-18164214IPR009057Homeodomain-like
PROSITE profilePS5129415.336167217IPR017930Myb domain
SMARTSM007177.0E-12167215IPR001005SANT/Myb domain
CDDcd001672.02E-12171213No hitNo description
PfamPF002493.2E-13171210IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MAFNNSILAN RALASPLTGD EVAVSYLASS SYGDPQFEHN LVAPSFMQAG GVQFMDAPLD  60
VSSLVARIGM TPAGFEMPEG AIVGSSYNTL GGVPIDVEEV PQPQTGSNDK PAPFKGSWTE  120
EEDSILKAMV TQLGERKWSV IAQSLPGRIG KQCRERWINH LRPDIKQNDI WTEEDDKLLI  180
GAHKYFGNRW SSIARFLPGR SENAIKNHWN ATKRSLKAKR RLKKKKSEQQ VPPSQLTILE  240
EYIRSLPPAS ESAAPPAAAS PPLQGPAYSG PIVPEAVHPP APGMEMNFNT ANLAGPPLSI  300
HLPGIINHSM PQLPDLNITC DPQEASYISY AMDAPSPAPQ LQLVTQDPQQ ATFSWFPFVE  360
YPTALNTGLA AGPSYYAGGS SSNAVANGYY SGAGAGYYYS EAGTSNAGGN GGEPAGDTGG  420
VVELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-411152144102C-Myb DNA-Binding Domain
1msf_C8e-411152144102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.10.0PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS580.0K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-41myb domain protein 98